Anyone remember North Stoke , probably trained by John Dunlop as it's a place in Arundel as far as I can remember , it ran up a sequence as a 3yo but wasn't entered or supplemented for the Epsom Derby against general opinion , wondered how high his rating reached and whether there's any evidence he may have given the Epsom winner any sort of race.
Anyone remember North Stoke , probably trained by John Dunlop as it's a place in Arundel as far as I can remember , it ran up a sequence as a 3yo but wasn't entered or supplemented for the Epsom Derby against general opinion , wondered how high his r
Hayden - I think North Stoke won at Haydock when I was there. Short price (11/8?) in a valuable 3yo hcap. I think Jimmy Bleasdale might have ridden it. It was Dunlop trained, looked as if he might be going along similar lines to Moon Madness, though I guess he didn't in the end.
Hayden - I think North Stoke won at Haydock when I was there. Short price (11/8?) in a valuable 3yo hcap. I think Jimmy Bleasdale might have ridden it. It was Dunlop trained, looked as if he might be going along similar lines to Moon Madness, though
Can anyone remember who trained Dred Scot? I think Kipper Lynch rode it several times - the horse won its fair share too!
What about sprinters ( I think) called Cry No More and Come Play With Me?
All these from mid/late 70's.
Can anyone remember who trained Dred Scot? I think Kipper Lynch rode it several times - the horse won its fair share too!What about sprinters ( I think) called Cry No More and Come Play With Me?All these from mid/late 70's.
alfie t allez france much better than dahlia in france .dahlia first king geo win was the best 3yo filly run iv ever seen .piggot never moves to beat top horses .i think the faster pace the better for her. in the u s a she would have been a superstar
alfie t allez france much better than dahlia in france .dahlia first king geo win was the best 3yo filly run iv ever seen .piggot never moves to beat top horses .i think the faster pace the better for her. in the u s a she would have been a supersta
North Stoke won the Bass club H'cap at Haydock in the then powerful Nelson Bunker Hunt colours. Was there that day too. Went upwards through the ranks until being beaten in the Champion Stakes.
North Stoke won the Bass club H'cap at Haydock in the then powerful Nelson Bunker Hunt colours. Was there that day too. Went upwards through the ranks until being beaten in the Champion Stakes.
The Buchanan Whisky Gold Cup run at Ascot was won by some great horses in the 60's and 70's:
Pendil Artifice I'm A Driver Bula Tree Tangle Flashy Boy Night Nurse Flyingbolt Into View
The Buchanan Whisky Gold Cup run at Ascot was won by some great horses in the 60's and 70's:PendilArtificeI'm A DriverBulaTree TangleFlashy BoyNight NurseFlyingboltInto View
AlfieT, you're almost certainly thinking of the 1982 John Smith's Magnet Cup. Lafontaine, ridden by Piggott and carrying 10-3 (including an 8lb penalty) went off joint fav for the race but it was won by Buzzards Bay, ridden by Birch, who came from last to first and won by a length and a half at 7/1 from Cannon King, the other joint fav.
AlfieT, you're almost certainly thinking of the 1982 John Smith's Magnet Cup. Lafontaine, ridden by Piggott and carrying 10-3 (including an 8lb penalty) went off joint fav for the race but it was won by Buzzards Bay, ridden by Birch, who came from la
Anybody remember Posse? Think that was what it was called. Real good horse. And Charlie Booth from Flaxton Gravel Pit Farm. My hero. Mademoiselle Derrière.
Anybody remember Posse? Think that was what it was called. Real good horse. And Charlie Booth from Flaxton Gravel Pit Farm. My hero. Mademoiselle Derrière.
Yes, I do remember Posse very well. He was really unlucky in the 1980 Two Thousand Guineas. The race was won by Nureyev who was disqualified and Posse was promoted to second place. He went on to win the St James's Palace Stakes at Royal Ascot and the Sussex Stakes at Goodwood, both times ridden with supreme confidence by Pat Eddery. The day before he won at Ascot a half share in him was purchased for $1,000,000.
Yes, I do remember Posse very well. He was really unlucky in the 1980 Two Thousand Guineas. The race was won by Nureyev who was disqualified and Posse was promoted to second place. He went on to win the St James's Palace Stakes at Royal Ascot and
Yamadori - won the Hunt Cup in 1977, ridden I believe by Lester Piggot, having finished 3rd in 1976. This fellow used to get miles behind, especially in his earlier races - almost tailed off, then come with a late storming run - something to get my then young heart racing
Yamadori - won the Hunt Cup in 1977, ridden I believe by Lester Piggot, having finished 3rd in 1976.This fellow used to get miles behind, especially in his earlier races - almost tailed off, then come with a late storming run - something to get my th
Augustine, it was not that race, although it was a left handed track, in my race Buzzards bay was beaten, maybe it was the race where Lafontaine picked up the 8lb penalty.
Augustine, it was not that race, although it was a left handed track, in my race Buzzards bay was beaten, maybe it was the race where Lafontaine picked up the 8lb penalty.
seens its wimbledon anyone remember a horse called virgina wade, one of my ist winners,also remember backing fearnaught in hunt cup and a stayer called japsilk,early winners also included sir montague,free state, and the lunatic ubedizzy trained by steve nessbitt
seens its wimbledon anyone remember a horse called virgina wade, one of my ist winners,also remember backing fearnaught in hunt cup and a stayer called japsilk,early winners also included sir montague,free state, and the lunatic ubedizzy trained by s
Sir Montagu was offered at around 10-1 just after winning at Goodwood and was punted right down to 11-4(i think) on the day and won it half the track after kicking on early in the straight
On of the easiest winners of the race that ive seen, it was the day after Wollow had won the "Benson and Hedges" beating Trepan, who hadnt had his usual dose of jungle Juice that day[;)]
Sir Montagu was offered at around 10-1 just after winning at Goodwood and was punted right down to 11-4(i think) on the day and won it half the track after kicking on early in the straightOn of the easiest winners of the race that ive seen, it was th
I knew him well - and was fortunate enough to 'catch him' when he won the Queen Elizbeth II Stakes At 50/1 in 1982..... having been 'with him' when he won 5 times the year before as a 3-yr-old.
Before the QEII race -
He was last turning into the straight in the John Smith's Magnet Cup - and then won by length and a half from Canon King 9/4 Jt-Fav - Buzzards started at 7/1 LAFONTAINE was the 9/4 Jt-Fav.
In his race BEFORE the Magnet Cup - The Royal Hong Kong Jockey Club Handicap at Sandown - Buzzards Bay tailed himself off, and was going nowhere - only to suddenly take off late in the race, to finish just outside the Places. LAFONTAINE Won the race - Piggott - 3/1 Fav
He beat Noalcoholic in the Queen Elizabeth II Stakes - BUZZARDS BAY stated at 50/1 - again coming from well back.
Finished tailed off in the Champion Stakes, following QEII win.
Hi, Alfie.BUZZARDS BAY I knew him well - and was fortunate enough to 'catch him' when he won the Queen Elizbeth II Stakes At 50/1 in 1982..... having been 'with him' when he won 5 times the year before as a 3-yr-old. Before the QEII race -He was last
Zil, the day Wollow won at York was my first ever day at the races. My dad took me and my younger brother. Piggott won the first race, the Acomb, on Padroug for O'Brien and I was hooked. Sarah Siddons won the Yorkshire Oaks and Coed Cochion the Melrose and Piggott on Jumping Hill (Murless) just got pipped in the mile handicap by Silver Steel (Brittain/ Carson).
Zil, the day Wollow won at York was my first ever day at the races. My dad took me and my younger brother. Piggott won the first race, the Acomb, on Padroug for O'Brien and I was hooked. Sarah Siddons won the Yorkshire Oaks and Coed Cochion the Melro
Mine was when Bula beat Tingle Creek in a match over 2m at Sandown, i had the "Tote Treble" up as well with Lord Oaksey winning the last leg, paid a really bad dividend though esp as Bula was around the 5/2 outsider of the two
We never forget our 1st day AugMine was when Bula beat Tingle Creek in a match over 2m at Sandown, i had the "Tote Treble" up as well with Lord Oaksey winning the last leg, paid a really bad dividend though esp as Bula was around the 5/2 outsider of
Does anyone remember a grand old handicapper from the 70s called Traffic Leader? I´m sure I saw it run twice on the same Musselburgh card around 1973?
And what was the name of the J Glover ridden (or trained) handicapper that won the Cambridgeshire at 25-1? I backed it and tipped it to all my mates - probably the last time I gave them a winner...
Does anyone remember a grand old handicapper from the 70s called Traffic Leader? I´m sure I saw it run twice on the same Musselburgh card around 1973?And what was the name of the J Glover ridden (or trained) handicapper that won the Cambridgeshire a
"Traffic Leader was a 13-year-old when Harry Bell ran him twice in an hour at Edinburgh in 1974. The same trainer ran Never Stop in consecutive races over hurdles at Newcastle in 1981; the four-year-old was unplaced and pulled up respectively."
"Traffic Leader was a 13-year-old when Harry Bell ran him twice in an hour at Edinburgh in 1974. The same trainer ran Never Stop in consecutive races over hurdles at Newcastle in 1981; the four-year-old was unplaced and pulled up respectively."
Traffic Leader (Harry Bell) goes close to winning two races in one day at Edinburgh. After Jock Skilling has partnered him to victory in the seller, the trainer's daughter, Margaret, takes over for the ladies' race and they are beaten a length into fourth behind Clear Melody (Steve Nesbitt/Diana Weeden)."
"July 1, 1974 Traffic Leader (Harry Bell) goes close to winning two races in one day at Edinburgh. After Jock Skilling has partnered him to victory in the seller, the trainer's daughter, Margaret, takes over for the ladies' race and they are beaten a
I remember vaguely a horse called Swift Fellow ridden by Kimberley?? running down my outside bet at around 40-1 called Mon Legionaire in the city and sub in the early to mid 70s
I remember vaguely a horse called Swift Fellow ridden by Kimberley?? running down my outside bet at around 40-1 called Mon Legionaire in the city and sub in the early to mid 70s
Anyone remember a chaser called Straightjacket,it was the first horse i ever saw fall ,i was standing next to the open ditch just before the stands at Sandown one day, i think Chris Read rode it, i think it was the same day Flying Diplomat won the Imperial cup.
Anyone remember a chaser called Straightjacket,it was the first horse i ever saw fall ,i was standing next to the open ditch just before the stands at Sandown one day, i think Chris Read rode it, i think it was the same day Flying Diplomat won the Im
some great old memories and names on here just a few more to throw into the mix . north stoke manor farm boy jebb lane full extent circus ring lyric fantasy marwell spindrifter pegwell bay the dealer al trui birds nest beacon light moorestyle kazaroun the dancer
some great old memories and names on here just a few more to throw into the mix .north stokemanor farm boyjebb lanefull extentcircus ringlyric fantasymarwellspindrifterpegwell baythe dealeral truibirds nestbeacon lightmoorestylekazarounthe dancer
Geoffrey Sale (from whose annual publication Hunter Chasers & Point-to-Pointer the above is taken) wrote in the 1968 annual that Baulking Green was “just about the most gallant animal that ever looked through a bridle”. Sale wrote of Baulking Green’s last race: “Broke down behind What A Myth at Newbury (on three legs from two out but would not be pulled up). The most courageous of horses. Will long be remembered”. Ron Liddiard wrote a biography of the horse (Baulking Green: Champion Hunter Chaser)
im almost sure i heard ex jockeyd.kieth admit on a tv programmecalled after dark that he stopped horses he was riding?can anyone add to this or vertify it?
When I was a nipper my old man would put my pocket money on (3 x 5p doubles and a 5p treble) and i got a good one up started with The Hertford. Go on my son.
When I was a nipper my old man would put my pocket money on (3 x 5p doubles and a 5p treble) and i got a good one up started with The Hertford. Go on my son.
Duncan Keith rode all trainer Walter Nightinal's horses.
Walter's ALWAYS made all the running, - more so than Mark Johnston's - and irrespective of whether they were bred to be a hold-up horse, or even resented the tactic.
They often say that the best way to get a horse beat is 'run it off the front'.
reluctant -Duncan Keith rode all trainer Walter Nightinal's horses.Walter's ALWAYS made all the running, - more so than Mark Johnston's - and irrespective of whether they were bred to be a hold-up horse, or even resented the tactic.They often say th
Mention of Nightingale and Keith, reminds me of their Derby 3rd I Say to the great Sea Bird. I had backed it at 33/1, having been impressed by it winning it's maiden at Kempton.
Mention of Nightingale and Keith, reminds me of their Derby 3rd I Say to the great Sea Bird. I had backed it at 33/1, having been impressed by it winning it's maiden at Kempton.
Apologies if already mentioned but does anyone remember Ten Up winning when ridden by Captain Hodges RA?
Between him,Gunner B and Staffordshire Knot,Colchester Garrison was not a safe place for bookies when they won.[:D][:D]
Apologies if already mentioned but does anyone remember Ten Up winning when ridden by Captain Hodges RA?Between him,Gunner B and Staffordshire Knot,Colchester Garrison was not a safe place for bookies when they won.
Was at Cheltenham when Ten Up won Gold Cup...think he beat Bula in driving rain
1975 , Bula emptied on the heaviest round in the last 40 years on Gold Cup day at the last fence , attempting to be the first Champion Hurdler to win The Gold Cup.
Was at Cheltenham when Ten Up won Gold Cup...think he beat Bula in driving rain1975 , Bula emptied on the heaviest round in the last 40 years on Gold Cup day at the last fence , attempting to be the first Champion Hurdler to win The Gold Cup.
I was at Cheltenham that day as well , ruined a decent suit and a good pair of shoes in appalling weather , remember Soothsayer splitting the above mentioned pair as the Winter 2nd string
I was at Cheltenham that day as well , ruined a decent suit and a good pair of shoes in appalling weather , remember Soothsayer splitting the above mentioned pair as the Winter 2nd string
Another great hunter chaser around in the 80s who never seemed to get beat was Royal Judgement,remeber him carrying 13-2lb to win at Sandown one afternoon, i think he was ridden by a Mr G.Wiltshire(7)..
Another great hunter chaser around in the 80s who never seemed to get beat was Royal Judgement,remeber him carrying 13-2lb to win at Sandown one afternoon, i think he was ridden by a Mr G.Wiltshire(7)..
Captain Hodges was a Royal Artillery officer and carrying on a military tradition of riding in the military races at Sandown as well as other courses.
Ten Up is probably responsible for my addiction to racing and betting when as a teenage soldier he won me a months wages the day Capt Hodges won on him.
History could be made in the near future if Lt Guy Disney succeeds in regaining his riding licence.He lost the lower part of his leg after an IED exploded.An accomplished rider before the incident his aim is to ride under rules,probably in one of the military races at Sandown.
The way he rides would put some pro jocks in the shade despite his "handicap".If he succeeds,lump on because there will rarely be a jockey as determined to win than he.[;)][;)]
Captain Hodges was a Royal Artillery officer and carrying on a military tradition of riding in the military races at Sandown as well as other courses.Ten Up is probably responsible for my addiction to racing and betting when as a teenage soldier he w
what about Linden Tree (walwyn/keith?), i remember it was 2nd in Mill Reef's Derby. I can't remember anything else about the horse. 15 years old, read summat in Mirror that morning, made me fancy one at Goodwood. 35p in me pocket, walked into local indie and put it on Jimmy the Singer in '76 Stewards Cup. 16/1! Please don't tell me I've got any of that wrong. And, do I win a prize for aftertimer of the month? Also, what about Blakeney? I remember watching it win the Derby in '69 but what did it do afterwards? Was it sent to stud immediately and did A.Budgett do something similar with Morston?
cheers, great thread
what about Linden Tree (walwyn/keith?), i remember it was 2nd in Mill Reef's Derby. I can't remember anything else about the horse. 15 years old, read summat in Mirror that morning, made me fancy one at Goodwood. 35p in me pocket, walked into loca
Interesting you mention Royal Judgement and for me probably his best ever run was attempting to give Burrough Hill Lad 19lb in the Welsh Grand National after attempting to make all , wonderful run when you think what the winner went on to achieve
http://www.youtube.com/watch?v=rAQbkP60wco
dambusterInteresting you mention Royal Judgement and for me probably his best ever run was attempting to give Burrough Hill Lad 19lb in the Welsh Grand National after attempting to make all , wonderful run when you think what the winner went on to ac
Anyone remember a lovely horse of Peter Walwyns called Leonardo Da Vinci? Remember him trotting up in I think the White Rose at Ascot and thinking he was a world beater - don´t think he won again!
Anyone remember a lovely horse of Peter Walwyns called Leonardo Da Vinci? Remember him trotting up in I think the White Rose at Ascot and thinking he was a world beater - don´t think he won again!
tip he won the wood ditton a long way before ascot fav for derby got beat in dant same owner as grundy
what about boldboy for lady beaver had my pocket money on every time he ran
tip he won the wood ditton a long way before ascot fav for derby got beat in dant same owner as grundywhat about boldboy for lady beaver had my pocket money on every time he ran
The earliest bet i remember making was in one of the classics,Meadow Court ridden by Lester....was really upset when he got beaten by Joe Mercer on Provoke. Still feel sad about it nearly 50 years later.
The earliest bet i remember making was in one of the classics,Meadow Court ridden by Lester....was really upset when he got beaten by Joe Mercer on Provoke. Still feel sad about it nearly 50 years later.
Remember him well, TTO. He'd won the Wood Ditton first time out and took the White Rose by 10 lengths. Became ante-post Derby fav and went to the Dante next. Started 10/11f and finished fifth behind Shirley Heights. Ran once more, at the Leger meeting, started fav and finished 8 lengths second of four. That was it. I've a vague recollection of him ending up at stud abroad but I could be wrong.
Remember him well, TTO. He'd won the Wood Ditton first time out and took the White Rose by 10 lengths. Became ante-post Derby fav and went to the Dante next. Started 10/11f and finished fifth behind Shirley Heights. Ran once more, at the Leger meetin
Interesting read lads,here's my memories of some of the mentioned horses plus two of my own. Ebobezersdouble-In the members race at the Zetland point 1/2 fav.horse jumps one fence then pulled up.The official excuse,the jockey thought she'd gone lame (only recently recovered from having a broken leg).Thought she'd broke her leg again. The Hertford-flapped this one Flying Ace-It's first run was the Members at the Berwicks point which it duly won at a double figure price,probably due to Doreen being the jockey.This horse could jump like a stag & one day at Friars Haugh I laid it to fall & it did fall. Coded Scrap-Owned by Herbie Newton,a scrap dealer from Durham who also had the pacers with a Susy prefix to their names. Spring Cabbage-Harry Blackshaw trained.Could this bloke set a one up for a bet. Two of mine. Young Ash Leaf-Trained I believe by the benign bishop,burst on to the scene at Newcastle at 25/1 & went on to prove itself a decent horse. Flatbush-Trained by Freddie Milburn.Decent sprinter that went on to a career at stud. There's another but I'm not putting its name on here as the trainer is still training but it flapped as Wee Mee.A tiny little thing but would not let any other thing in the box when going to the races.Despite its size it carried top weight on the flapping circuit & may have won the Trademens(I'm not sure of that though)
Interesting read lads,here's my memories of some of the mentioned horses plus two of my own.Ebobezersdouble-In the members race at the Zetland point 1/2 fav.horse jumps one fence then pulled up.The official excuse,the jockey thought she'd gone lame (
I Remember being at Sandown when i thought the marvellous Crisp was going to take the Whitbread Gold cup of 1975. Jumping the last on the far side he went a couple clear of the field and there was a roar from the crowd, sadly he got pegged back and gave the second last a almighty clout.
A bit ironic as April The Seventh usually made the mistake, any way he fought out a finish with Captain Christy with, if i remember rightly, Ten Up being unplaced. Imagine having two gold cup winners in a Whitbread nowdays!!
I Remember being at Sandown when i thought the marvellous Crisp was going to take the Whitbread Gold cup of 1975. Jumping the last on the far side he went a couple clear of the field and there was a roar from the crowd, sadly he got pegged back and g
Just a couple of memories of Leonardo da Vinci (the horse)..
I was in a betting shop when the Wood Ditton was on. In the 10 minutes before the race, his price went from 7/2 out to 7/1, and then back in to 7/2 again. I'd never seen anything quite like that before. I think it said in the Sporting Life the next day that John Banks had been fielding big against it.
Then I was at York for the Dante, after that White Rose win, and all eyes seemed to be on him in the parade ring. He was a really fine looking dark bay, and in the Wildenstein colours you thought you were looking at something special. Then he got stuffed. I can only remember Shirley Heights battling with a Clive Brittain horse (Tarzan?) in the final furlong.
Talking of Dante disappointments - does anyone have any views of Nash House on Dante day? He had been immensely impressive at Newbury, and I was watching on TV as he drifted from a morning 6/4 to 11/4, and when he came into the parade ring, Brough Scott commented that he looked relaxed - then, noticing that he was walking with his head practically on the floor, said that if he was any more relaxed he'd be asleep. In the race, he was pretty lifeless. He was probably the only horse I've seen that actually looked doped, but I don't remember anyone saying anything or speculating.
Just a couple of memories of Leonardo da Vinci (the horse)..I was in a betting shop when the Wood Ditton was on. In the 10 minutes before the race, his price went from 7/2 out to 7/1, and then back in to 7/2 again. I'd never seen anything quite like
Anyone remember Derek Kent bringing the NZ horses across? Remember there being 3
Grand Canyon Navigation
one other whose name slips my blonde brain cells, think the name began with Z?
Anyone remember Derek Kent bringing the NZ horses across? Remember there being 3Grand CanyonNavigationone other whose name slips my blonde brain cells, think the name began with Z?
One of my fav trainers to follow, of the old school, was Neville Crump, with his two able jocks David Atkins and Colin Hawkins. He was one of the best trainers of chasers I can remember: Even Melody of course was a stalwart but I loved Ballet Lord and thought he could have been special. Unfortunately he never seemed to get his jumping together...
One of my fav trainers to follow, of the old school, was Neville Crump, with his two able jocks David Atkins and Colin Hawkins. He was one of the best trainers of chasers I can remember: Even Melody of course was a stalwart but I loved Ballet Lord an
The Happy Hooker Sportsky(came from last to first at Chester). Friday Street(Bath Regular) Given(Loved Newton Abbot in August) Mist Halo (ran in ladies races)
The Happy Hooker Sportsky(came from last to first at Chester). Friday Street(Bath Regular) Given(Loved Newton Abbot in August) Mist Halo (ran in ladies races)